Loading...
Statistics
Advertisement

Persianrugservice.org

Advertisement
Conversion Technology Metas Server
Persianrugservice.org is hosted in United States / Jacksonville . Persianrugservice.org uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Javascript, Php, Number of used javascripts: 6. First javascripts: BrowserBehavior.js, Utils.js, Shared.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Persianrugservice.org

Technology

Number of occurences: 3
  • CSS
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 6
  • browserBehavior.js
  • utils.js
  • shared.js
  • navigation.js
  • popup.js
  • ResourceLoader.js

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Persianrugservice.org

SSL certificate

    • name: /OU=GT37193146/OU=See www.rapidssl.com/resources/cps (c)12/OU=Domain Control Validated - RapidSSL(R)/CN=*.sites.myregisteredsite.com
    • subject:
      • OU:
        • 0: GT37193146
        • 1: See www.rapidssl.com/resources/cps (c)12
        • 2: Domain Control Validated - RapidSSL(R)
      • CN: *.sites.myregisteredsite.com
    • hash: edbf4843
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA - G3
    • version: 2
    • serialNumber: 251369
    • validFrom: 150420192224Z
    • validTo: 170330230641Z
    • validFrom_time_t: 1429557744
    • validTo_time_t: 1490915201
    • extensions:
      • authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
      • authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.sites.myregisteredsite.com
      • crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
      • basicConstraints: CA:FALSE
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal

Meta - Persianrugservice.org

Number of occurences: 4
  • Name:
    Content: text/html; charset=UTF-8
  • Name: ROBOTS
    Content: INDEX,FOLLOW
  • Name: DESCRIPTION
    Content:
  • Name: KEYWORDS
    Content:

Server / Hosting

  • IP: 209.237.150.20
  • Latitude: 30.14
  • Longitude: -81.54
  • Country: United States
  • City: Jacksonville

Rname

  • c.ns.interland.net
  • a.ns.interland.net
  • b.ns.interland.net
  • mx.myregisteredsite.com

Target

  • hostmaster.interland.net

HTTP Header Response

HTTP/1.1 200 OK Date: Mon, 02 May 2016 12:52:39 GMT Server: Apache Last-Modified: Fri, 04 Apr 2014 02:18:19 GMT ETag: "1fc8080-3bf7-219230c0" Accept-Ranges: bytes Content-Length: 15351 Cache-Control: max-age=-65615360 Expires: Fri, 04 Apr 2014 02:23:19 GMT Vary: Accept-Encoding,User-Agent Content-Type: text/html

DNS

host: persianrugservice.org
  1. class: IN
  2. ttl: 3599
  3. type: A
  4. ip: 209.237.150.20
host: persianrugservice.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: c.ns.interland.net
host: persianrugservice.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: a.ns.interland.net
host: persianrugservice.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: b.ns.interland.net
host: persianrugservice.org
  1. class: IN
  2. ttl: 1800
  3. type: SOA
  4. mname: a.ns.interland.net
  5. rname: hostmaster.interland.net
  6. serial: 2014060300
  7. refresh: 1800
  8. retry: 900
  9. expire: 864000
  10. minimum-ttl: 2560
host: persianrugservice.org
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 5
  5. target: mx.myregisteredsite.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ersianrugservice.org, www.piersianrugservice.org, www.iersianrugservice.org, www.pkersianrugservice.org, www.kersianrugservice.org, www.puersianrugservice.org, www.uersianrugservice.org, www.pjersianrugservice.org, www.jersianrugservice.org, www.plersianrugservice.org, www.lersianrugservice.org, www.prsianrugservice.org, www.pexrsianrugservice.org, www.pxrsianrugservice.org, www.pesrsianrugservice.org, www.psrsianrugservice.org, www.pewrsianrugservice.org, www.pwrsianrugservice.org, www.perrsianrugservice.org, www.prrsianrugservice.org, www.pefrsianrugservice.org, www.pfrsianrugservice.org, www.pevrsianrugservice.org, www.pvrsianrugservice.org, www.pecrsianrugservice.org, www.pcrsianrugservice.org, www.peqrsianrugservice.org, www.pqrsianrugservice.org, www.pearsianrugservice.org, www.parsianrugservice.org, www.peyrsianrugservice.org, www.pyrsianrugservice.org, www.pesianrugservice.org, www.perisianrugservice.org, www.peisianrugservice.org, www.perosianrugservice.org, www.peosianrugservice.org, www.perlsianrugservice.org, www.pelsianrugservice.org, www.perlsianrugservice.org, www.pelsianrugservice.org, www.per.sianrugservice.org, www.pe.sianrugservice.org, www.perianrugservice.org, www.perseianrugservice.org, www.pereianrugservice.org, www.perswianrugservice.org, www.perwianrugservice.org, www.persdianrugservice.org, www.perdianrugservice.org, www.persxianrugservice.org, www.perxianrugservice.org, www.persfianrugservice.org, www.perfianrugservice.org, www.persgianrugservice.org, www.pergianrugservice.org, www.perstianrugservice.org, www.pertianrugservice.org, www.persanrugservice.org, www.persiranrugservice.org, www.persranrugservice.org, www.persifanrugservice.org, www.persfanrugservice.org, www.persivanrugservice.org, www.persvanrugservice.org, www.persikanrugservice.org, www.perskanrugservice.org, www.persi,anrugservice.org, www.pers,anrugservice.org, www.persibanrugservice.org, www.persbanrugservice.org, www.persiganrugservice.org, www.persganrugservice.org, www.persitanrugservice.org, www.perstanrugservice.org, www.persiyanrugservice.org, www.persyanrugservice.org, www.persiuanrugservice.org, www.persuanrugservice.org, www.persijanrugservice.org, www.persjanrugservice.org, www.persimanrugservice.org, www.persmanrugservice.org, www.persinanrugservice.org, www.persnanrugservice.org, www.persinrugservice.org, www.persiaonrugservice.org, www.persionrugservice.org, www.persiapnrugservice.org, www.persipnrugservice.org, www.persia9nrugservice.org, www.persi9nrugservice.org, www.persianrugservice.org, www.persinrugservice.org, www.persiainrugservice.org, www.persiinrugservice.org, www.persiaunrugservice.org, www.persiunrugservice.org, www.persiarugservice.org, www.persiannrugservice.org, www.persianrugservice.org, www.persianhrugservice.org, www.persiahrugservice.org, www.persianjrugservice.org, www.persiajrugservice.org, www.persiankrugservice.org, www.persiakrugservice.org, www.persianlrugservice.org, www.persialrugservice.org, www.persian rugservice.org, www.persia rugservice.org, www.persianugservice.org, www.persianriugservice.org, www.persianiugservice.org, www.persianrougservice.org, www.persianougservice.org, www.persianrlugservice.org, www.persianlugservice.org, www.persianrlugservice.org, www.persianlugservice.org, www.persianr.ugservice.org, www.persian.ugservice.org, www.persianrgservice.org, www.persianruwgservice.org, www.persianrwgservice.org, www.persianruegservice.org, www.persianregservice.org, www.persianrusgservice.org, www.persianrsgservice.org, www.persianruagservice.org, www.persianragservice.org, www.persianruservice.org, www.persianrugsservice.org, www.persianrusservice.org, www.persianrugxservice.org, www.persianruxservice.org, www.persianrugyservice.org, www.persianruyservice.org, www.persianrughservice.org, www.persianruhservice.org, www.persianrugnservice.org, www.persianrunservice.org, www.persianrugcservice.org, www.persianrucservice.org, www.persianrugdservice.org, www.persianrudservice.org, www.persianrugeservice.org, www.persianrueservice.org, www.persianrugrservice.org, www.persianrurservice.org, www.persianrugtservice.org, www.persianrutservice.org, www.persianrugbservice.org, www.persianrubservice.org, www.persianrugvservice.org, www.persianruvservice.org, www.persianrugervice.org, www.persianrugseervice.org, www.persianrugeervice.org, www.persianrugswervice.org, www.persianrugwervice.org, www.persianrugsdervice.org, www.persianrugdervice.org, www.persianrugsxervice.org, www.persianrugxervice.org, www.persianrugsfervice.org, www.persianrugfervice.org, www.persianrugsgervice.org, www.persianruggervice.org, www.persianrugstervice.org, www.persianrugtervice.org,

Other websites we recently analyzed

  1. christsmercychurch.com
    The official webpage of Christ's Mercy Church in Katy, Texas. Find out about who we are and what we do, as well as sermons and discipleship lessons.
    New York (United States) - 198.185.159.144
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  2. smallkitchenappliancesreview.com
    Virgin Islands, British - 208.91.197.13
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. Bellingham Dental Group – Dentist in Bellingham, WA - Dentist Bellingham WA with Dr. Parker Haley
    Bellingham Dentist Dr. Parker Haley leads Bellingham Dental Group, offering a range of dental services including student & emergency services. 360-734-6190
    Scottsdale (United States) - 50.62.89.138
    G Analytics ID: UA-42878548-1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Google Font API, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Google +1 Button
    Number of Javascript: 13
    Number of meta tags: 5
  4. Home
    My Joomla CMS
    Australia - 221.121.144.145
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, SuperFish, Joomla
    Number of Javascript: 15
    Number of meta tags: 3
  5. ylvx.net
    Ottawa (Canada) - 47.90.20.17
    Server software: Microsoft-IIS/7.5
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  6. beorc.com
    Wayne (United States) - 74.208.84.115
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  7. Changeist: Futures, Innovation, Strategic Design
    Changeist is a post-national research, consulting and creative group focused on strategic innovation for the future.
    New York (United States) - 198.49.23.145
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Google Analytics, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  8. Susie Wong Bar & Restaurant - Windsor
    Susie Wong Bar & Restaurant - 12 Chapel St Windsor, VIC - 03 9510 1875 - OPENING HOURS Tue | Wed | Thur 6pm-late Fri | Sat | Sun 12-3pm & 6pm-late
    Adelaide (Australia) - 175.107.184.169
    Server software: Apache
    Technology: CSS, Html
    Number of Javascript: 4
    Number of meta tags: 3
  9. Herzlich Willkommen!
    Germany - 78.46.84.82
    Server software: nginx
    Technology: CSS, Html
    Number of meta tags: 2
  10. מכונות כביסה ומייבשים להשכרה – קלינומט החזקות
    קלינומט אחזקות משכירה מכונות כביסה ומכונות ייבוש למוסדות ולגופים שונים. המכונות מופעלות באמצעים טכנולוגיים פשוטים המותאמים לדרישות הלקוח. באתר ניתן למצוא מידע אודות החברה, הציוד, השירות הניתן וטופס ליצירת קשר.
    Israel - 212.199.115.180
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 7
    Number of meta tags: 5

Check Other Websites